Structure of PDB 1gau Chain A Binding Site BS01

Receptor Information
>1gau Chain A (length=60) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDG
IQTRNRKVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gau NMR structure of a specific DNA complex of Zn-containing DNA binding domain of GATA-1.
ResolutionN/A
Binding residue
(original residue number in PDB)		L17 W18 R54
Binding residue
(residue number reindexed from 1)		L17 W18 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gau, PDBe:1gau, PDBj:1gau
PDBsum1gau
PubMed8332909
UniProtP17678|GATA1_CHICK Erythroid transcription factor (Gene Name=GATA1)

[Back to BioLiP]