Structure of PDB 1g5q Chain A Binding Site BS01

Receptor Information

>1g5q Chain A (length=174) Species: 1282 (Staphylococcus epidermidis)

MYGKLLICATASINVININHYIVELKQHFDEVNILFSPSSKNFINTDVLK
LFCDNLYDEIKDPLLNNINIVENHEYILVLPASANTINKIANGICDNLLT
TVCLTGYQKLFIFPNMNIRMWGNPFLQKNIDLLKNNDVKVYSPDMNKSFE
ISSGRYKNNITMPNIENVLNFVLN

Ligand information

>1g5q Chain M (length=5) Species: 1282 (Staphylococcus epidermidis)

DSYTC

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1g5q Crystal structure of the peptidyl-cysteine decarboxylase EpiD complexed with a pentapeptide substrate.
• Resolution: 2.57 Å
• Binding residue (original residue number in PDB): N14 N117 S148 F149 E150 I151 S152 Y156 N159 T161 M162
• Binding residue (residue number reindexed from 1): N14 N117 S148 F149 E150 I151 S152 Y156 N159 T161 M162

Enzymatic activity

• Catalytic site (original residue number in PDB): N67 S153
• Catalytic site (residue number reindexed from 1): N67 S153
• Enzyme Commision number: 4.1.1.-

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004633 phosphopantothenoylcysteine decarboxylase activity
• GO:0010181 FMN binding
• GO:0016829 lyase activity

Biological Process

• GO:0015937 coenzyme A biosynthetic process

Cellular Component

• GO:0071513 phosphopantothenoylcysteine decarboxylase complex

External links

• PDB: RCSB:1g5q, PDBe:1g5q, PDBj:1g5q
• PDBsum: 1g5q
• PubMed: 11101502
• UniProt: P30197|EPID_STAEP Epidermin decarboxylase (Gene Name=epiD)