Structure of PDB 1g5j Chain A Binding Site BS01

Receptor Information
>1g5j Chain A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAV
KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVN
WGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENG
GWDTFVELYGNNAAAESRKGQERLE
Ligand information
>1g5j Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NLWAAQRYGRELRRMSDEFVDSFKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g5j Rationale for Bcl-xL/Bad peptide complex formation from structure, mutagenesis, and biophysical studies.
ResolutionN/A
Binding residue
(original residue number in PDB)		A97 F101 Y105 A108 L112 L116 S126 Q129 V130 G142 R143 F150 L198 Y199 A203 A204 S207
Binding residue
(residue number reindexed from 1)		A57 F61 Y65 A68 L72 L76 S86 Q89 V90 G102 R103 F110 L158 Y159 A163 A164 S167
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:1g5j, PDBe:1g5j, PDBj:1g5j
PDBsum1g5j
PubMed11206074
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]