Structure of PDB 1g1s Chain A Binding Site BS01

Receptor Information
>1g1s Chain A (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYW
IGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSA
PGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYG
PECEYVRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g1s Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe(X) and PSGL-1.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
A9 Y45 S46 S47 R85 H108 L110 K111 K112 H114
Binding residue
(residue number reindexed from 1)
A9 Y45 S46 S47 R85 H108 L110 K111 K112 H114
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1g1s, PDBe:1g1s, PDBj:1g1s
PDBsum1g1s
PubMed11081633
UniProtP16109|LYAM3_HUMAN P-selectin (Gene Name=SELP)

[Back to BioLiP]