Structure of PDB 1fyk Chain A Binding Site BS01

Receptor Information
>1fyk Chain A (length=88) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKH
SNFASFVRQLNMYGWHKVQDVKSGNNDSRWEFENERHA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fyk Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		P195 A196 K200
Binding residue
(residue number reindexed from 1)		P3 A4 K8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1fyk, PDBe:1fyk, PDBj:1fyk
PDBsum1fyk
PubMed11599025
UniProtP22121|HSF_KLULA Heat shock transcription factor (Gene Name=HSF)

[Back to BioLiP]