Structure of PDB 1fy4 Chain A Binding Site BS01

Receptor Information
>1fy4 Chain A (length=224) Species: 5507 (Fusarium oxysporum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSG
FQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNI
GYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATC
RAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNG
CARPNYSGVYASVGALRSFIDTYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fy4 Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
Resolution0.81 Å
Binding residue
(original residue number in PDB)		H57 D189 S190 Q192 G193 S195 W215 G216
Binding residue
(residue number reindexed from 1)		H41 D174 S175 Q177 G178 S180 W197 G198
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H41 D84 Q177 G178 D179 S180 G181
Enzyme Commision number 3.4.21.4: trypsin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1fy4, PDBe:1fy4, PDBj:1fy4
PDBsum1fy4
PubMed11134922
UniProtP35049|TRYP_FUSOX Trypsin

[Back to BioLiP]