Structure of PDB 1fxl Chain A Binding Site BS01

Receptor Information
>1fxl Chain A (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVN
YIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTM
TQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGL
NGQKPSGATEPITVKFA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fxl Structural basis for recognition of AU-rich element RNA by the HuD protein.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		I42 N44 Y45 K69 S79 L80 F84 K108 T109 K111 A115 R116 S118 I122 Y128 I152 T153 R155 L157 R166 F170 R172 K201
Binding residue
(residue number reindexed from 1)		I6 N8 Y9 K33 S43 L44 F48 K72 T73 K75 A79 R80 S82 I86 Y92 I116 T117 R119 L121 R130 F134 R136 K165
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1fxl, PDBe:1fxl, PDBj:1fxl
PDBsum1fxl
PubMed11175903
UniProtP26378|ELAV4_HUMAN ELAV-like protein 4 (Gene Name=ELAVL4)

[Back to BioLiP]