Structure of PDB 1fu5 Chain A Binding Site BS01

Receptor Information
>1fu5 Chain A (length=111) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTL
TLRKGGNNKSIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKY
Ligand information
>1fu5 Chain B (length=15) Species: 10636 (Murine polyomavirus strain A2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEEYMPMEDLYLDIL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fu5 NMR structure of the N-SH2 of the p85 subunit of phosphoinositide 3-kinase complexed to a doubly phosphorylated peptide reveals a second phosphotyrosine binding site.
ResolutionN/A
Binding residue
(original residue number in PDB)		W13 R20 R38 A40 T42 T49 N58 K59 S60 I61 K62 I63 F72 S73 D74 F78 L84 Y88 N90 E91 S92 L93 Q95 K99 L100 D101 V102 K103
Binding residue
(residue number reindexed from 1)		W13 R20 R38 A40 T42 T49 N58 K59 S60 I61 K62 I63 F72 S73 D74 F78 L84 Y88 N90 E91 S92 L93 Q95 K99 L100 D101 V102 K103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1fu5, PDBe:1fu5, PDBj:1fu5
PDBsum1fu5
PubMed11123912
UniProtQ63787|P85A_RAT Phosphatidylinositol 3-kinase regulatory subunit alpha (Gene Name=Pik3r1)

[Back to BioLiP]