Structure of PDB 1fpr Chain A Binding Site BS01

Receptor Information
>1fpr Chain A (length=284) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGR
DSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQE
NSRVIVMTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKL
RTLQVSPLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQES
LPHAGPIIVHSSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVR
AQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fpr Structural basis for substrate specificity of protein-tyrosine phosphatase SHP-1.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K259 Y278 N280 I281 R360 K362 S455 S456 A457 I459 R461 R494 S498 G499 Q502
Binding residue
(residue number reindexed from 1)		K15 Y34 N36 I37 R116 K118 S211 S212 A213 I215 R217 R250 S254 G255 Q258
Enzymatic activity
Catalytic site (original residue number in PDB) D421 S455 R461 T462 Q502
Catalytic site (residue number reindexed from 1) D177 S211 R217 T218 Q258
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
Biological Process
GO:0006470 protein dephosphorylation
GO:0016311 dephosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1fpr, PDBe:1fpr, PDBj:1fpr
PDBsum1fpr
PubMed10660565
UniProtP29350|PTN6_HUMAN Tyrosine-protein phosphatase non-receptor type 6 (Gene Name=PTPN6)

[Back to BioLiP]