Structure of PDB 1fiz Chain A Binding Site BS01

Receptor Information
>1fiz Chain A (length=263) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVGGMSAEPGAWPWMVSLQIFMYHNNRRYHTCGGILLNSHWVLTAAHCFK
NKKKVTDWRLIFGANEVVWGSNKPVKPPLQERFVEEIIIHEKYVSGLEIN
DIALIKITPPVPCGPFIGPGCLPQFKAGPPRAPQTCWVTGWGYLKEKGPR
TSPTLQEARVALIDLELCNSTRWYNGRIRSTNVCAGYPRGKIDTCQGDSG
GPLMCRDRAENTFVVVGITSWGVGCARAKRPGVYTSTWPYLNWIASKIGS
NALQMVQLGTPPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fiz Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		P24 G25 A26 W27 W29 S49 C114 G115 P116 F117 I118 G119 P120 G121 C122 T202D M249 V250
Binding residue
(residue number reindexed from 1)		P9 G10 A11 W12 W14 S39 C113 G114 P115 F116 I117 G118 P119 G120 C121 T212 M255 V256
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H47 D101 Q196 G197 D198 S199 G200
Enzyme Commision number 3.4.21.10: acrosin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1fiz, PDBe:1fiz, PDBj:1fiz
PDBsum1fiz
PubMed11080640
UniProtP08001|ACRO_PIG Acrosin (Gene Name=ACR)

[Back to BioLiP]