Structure of PDB 1fiw Chain A Binding Site BS01

Receptor Information
>1fiw Chain A (length=260) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGQDAAHGAWPWMVSLQIFTYHNNRRYHVCGGSLLNSQWLLTAAHCFR
IKKKVTDWRLIFGAKEVEWGTNKPVKPPLQERYVEKIIIHEKYSASSEAN
DIALMKITPPVTCGHFIGPGCLPQFRAGPPRVPQTCWVAGWGFLQENARR
TSPMLQEARVDLIDLGLCNSTRWYNGRIRSTNVCAGYPEGKIDTCQGDSG
GPLMCKDSAENSYVVVGITSWGVGCARAKRPGVYTSTWSYLNWIASKIGS
TAVHMIQLPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fiw Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		H24 G25 A26 W27 P28 W29 T113 C114 G115 H116 F117 P120 G121 C122 S202D Y203 I250
Binding residue
(residue number reindexed from 1)		H9 G10 A11 W12 P13 W14 T112 C113 G114 H115 F116 P119 G120 C121 S212 Y213 I256
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H47 D101 Q196 G197 D198 S199 G200
Enzyme Commision number 3.4.21.10: acrosin.
Gene Ontology
Molecular Function
GO:0004040 amidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005537 D-mannose binding
GO:0008236 serine-type peptidase activity
GO:0042806 fucose binding
Biological Process
GO:0006508 proteolysis
GO:0007190 activation of adenylate cyclase activity
GO:0007338 single fertilization
GO:0007340 acrosome reaction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1fiw, PDBe:1fiw, PDBj:1fiw
PDBsum1fiw
PubMed11080640
UniProtQ9GL10|ACRO_SHEEP Acrosin (Fragment) (Gene Name=ACR)

[Back to BioLiP]