Structure of PDB 1ff1 Chain A Binding Site BS01

Receptor Information
>1ff1 Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWE
LSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ff1 Molecular mechanism of NPF recognition by EH domains.
ResolutionN/A
Binding residue
(original residue number in PDB)		K37 L40 L41 V47 L50 G51 W54 E55 D58 H61 G63
Binding residue
(residue number reindexed from 1)		K32 L35 L36 V42 L45 G46 W49 E50 D53 H56 G58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1ff1, PDBe:1ff1, PDBj:1ff1
PDBsum1ff1
PubMed11062555
UniProtP42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 (Gene Name=EPS15)

[Back to BioLiP]