Structure of PDB 1f93 Chain A Binding Site BS01

Receptor Information

>1f93 Chain A (length=103) Species: 10116 (Rattus norvegicus)

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMT
RVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAV
SMT

Ligand information

>1f93 Chain F (length=27) Species: 10090 (Mus musculus)

LSQLQTELLAALLESGLSKEALIQALG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1f93 Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): N44 R45 G48 R52 L55
• Binding residue (residue number reindexed from 1): N43 R44 G47 R51 L54

Enzymatic activity

• Catalytic site (original residue number in PDB): E58 H62 H63 H80 E81 D89
• Catalytic site (residue number reindexed from 1): E57 H61 H62 H79 E80 D88
• Enzyme Commision number: 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.

Gene Ontology

Molecular Function

• GO:0003713 transcription coactivator activity
• GO:0004505 phenylalanine 4-monooxygenase activity
• GO:0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity
• GO:0016829 lyase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006558 L-phenylalanine metabolic process
• GO:0006729 tetrahydrobiopterin biosynthetic process
• GO:0008150 biological_process
• GO:0019293 tyrosine biosynthetic process, by oxidation of phenylalanine
• GO:0043393 regulation of protein binding
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:1f93, PDBe:1f93, PDBj:1f93
• PDBsum: 1f93
• PubMed: 10966642
• UniProt: P61459|PHS_RAT Pterin-4-alpha-carbinolamine dehydratase (Gene Name=Pcbd1)