Structure of PDB 1f6o Chain A Binding Site BS01

Receptor Information
>1f6o Chain A (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLG
PEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACV
LLRALEPLEGLETMRQLRSTLSRVLKDRELCSGPSKLCQALAINKSFDQR
DLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPW
VSVVDRVAEQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f6o Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y127 H136 Y159 I161 Y162 Y165 R197 G217 P218 S219 K220 G263 H266
Binding residue
(residue number reindexed from 1)		Y48 H57 Y80 I82 Y83 Y86 R118 G133 P134 S135 K136 G179 H182
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
Biological Process
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f6o, PDBe:1f6o, PDBj:1f6o
PDBsum1f6o
PubMed11106395
UniProtP29372|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]