Structure of PDB 1f4r Chain A Binding Site BS01

Receptor Information
>1f4r Chain A (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPE
DEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVLL
RALEPLEGLETMRQLRSTVLKDRELCSGPSKLCQALAINKSFDQRDLAQD
EAVWLERGPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f4r Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y127 A135 H136 M149 Y159 I161 Y162 Y165 N169 L180 R182 R197 G217 P218 S219 K220 G263
Binding residue
(residue number reindexed from 1)		Y46 A54 H55 M68 Y78 I80 Y81 Y84 N88 L99 R101 R116 G128 P129 S130 K131 G168
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
Biological Process
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f4r, PDBe:1f4r, PDBj:1f4r
PDBsum1f4r
PubMed11106395
UniProtP29372|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]