Structure of PDB 1eyg Chain A Binding Site BS01

Receptor Information
>1eyg Chain A (length=112) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKE
QTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTE
VVVNVGGTMQML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eyg Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K1062 V1066 Y1070 T1108 Q1110 M1111 L1112
Binding residue
(residue number reindexed from 1)		K62 V66 Y70 T108 Q110 M111 L112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1eyg, PDBe:1eyg, PDBj:1eyg
PDBsum1eyg
PubMed10932248
UniProtP0AGE0|SSB_ECOLI Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]