Structure of PDB 1exj Chain A Binding Site BS01

Receptor Information

>1exj Chain A (length=275) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIH
LDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALE
QTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASY
SKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISS
ITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVY
ELIIPIHYSPKKQEEYRVEMKIRIA

Ligand information

>1exj Chain M (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

accctccccttaggggagggt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1exj Crystal structure of the transcription activator BmrR bound to DNA and a drug.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	I8 G9 R23 T40 S41 Y42 R43
Binding residue (residue number reindexed from 1)	I6 G7 R21 T38 S39 Y40 R41

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1exj, PDBe:1exj, PDBj:1exj
PDBsum	1exj
PubMed	11201751
UniProt	P39075\|BMRR_BACSU Multidrug-efflux transporter 1 regulator (Gene Name=bmrR)

[Back to BioLiP]