Structure of PDB 1evh Chain A Binding Site BS01

Receptor Information
>1evh Chain A (length=111) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGR
KIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFA
SAMMHALEVLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1evh Structure of the enabled/VASP homology 1 domain-peptide complex: a key component in the spatial control of actin assembly.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
Y16 W23 F77 Q79 R81
Binding residue
(residue number reindexed from 1)
Y15 W22 F76 Q78 R80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1evh, PDBe:1evh, PDBj:1evh
PDBsum1evh
PubMed10338211
UniProtQ03173|ENAH_MOUSE Protein enabled homolog (Gene Name=Enah)

[Back to BioLiP]