Structure of PDB 1eqz Chain A Binding Site BS01

Receptor Information
>1eqz Chain A (length=125) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVY
LAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKV
TIAQGGVLPNIQAVLLPKKTDSHKA
Ligand information
>1eqz Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eqz Asymmetries in the nucleosome core particle at 2.5 A resolution.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S16 R17 R29 R32 R42 R77
Binding residue
(residue number reindexed from 1)		S16 R17 R29 R32 R42 R77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1eqz, PDBe:1eqz, PDBj:1eqz
PDBsum1eqz
PubMed11092917
UniProtP02263|H2A4_CHICK Histone H2A-IV

[Back to BioLiP]