Structure of PDB 1eoj Chain A Binding Site BS01

Receptor Information
>1eoj Chain A (length=278) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGADCGLRPLFEKKSLEDKTERELLESYIIVEGSDAEIGMSPWQVMLFRK
SPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRY
ERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLP
DRETAASLLQAGYKGRVTGWGNLKEGQPSVLQVVNLPIVERPVCKDSTRI
RITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGE
GCDRDGKYGFYTHVFRLKKWIQKVIDQF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eoj Design of P1' and P3' residues of trivalent thrombin inhibitors and their crystal structures.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		F34 Q38 L40 L41 H57 W60D K60F R73 T74 Y76 I82 L99 D189 A190 E192 S195 W215 G216 G219
Binding residue
(residue number reindexed from 1)		F48 Q53 L55 L56 H72 W79 K81 R97 T98 Y100 I107 L125 D220 A221 E223 S226 W248 G249 G251
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 E192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H72 D128 E223 G224 D225 S226 G227
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1eoj, PDBe:1eoj, PDBj:1eoj
PDBsum1eoj
PubMed10694407
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]