Structure of PDB 1emu Chain A Binding Site BS01

Receptor Information
>1emu Chain A (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEP
CDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDP
AMFDQAQTEIQATMEENTYPSFLKSDIYLEYT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1emu Structural basis of the Axin-adenomatous polyposis coli interaction.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D131 I136 D153 F156 A157 G160 L177 A180 R183
Binding residue
(residue number reindexed from 1)		D15 I20 D37 F40 A41 G44 L61 A64 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0090090 negative regulation of canonical Wnt signaling pathway

View graph for
Biological Process
External links
PDB RCSB:1emu, PDBe:1emu, PDBj:1emu
PDBsum1emu
PubMed10811618
UniProtO15169|AXIN1_HUMAN Axin-1 (Gene Name=AXIN1)

[Back to BioLiP]