Structure of PDB 1elr Chain A Binding Site BS01

Receptor Information
>1elr Chain A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFE
KGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIH
FYNKSLAEHRTPDVLKKCQQAEKILKEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1elr Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
K229 N233 Y236 T260 N264 A267 F270 E271 Q298 K301 R305 N308
Binding residue
(residue number reindexed from 1)
K8 N12 Y15 T39 N43 A46 F49 E50 Q77 K80 R84 N87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1elr, PDBe:1elr, PDBj:1elr
PDBsum1elr
PubMed10786835
UniProtP31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 (Gene Name=STIP1)

[Back to BioLiP]