Structure of PDB 1ekz Chain A Binding Site BS01

Receptor Information
>1ekz Chain A (length=76) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDEGDKKSPISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIV
TEGEGNGKKVSKKRAAEKMLVELQKL
Ligand information
>1ekz Chain B (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacagcugucccuucggggacagcugucc
<<<<<<<<<<<<<....>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ekz RNA recognition by a Staufen double-stranded RNA-binding domain.
ResolutionN/A
Binding residue
(original residue number in PDB)		K7 Q12 E15 K19 P34 A35 H36 M37 K38 K58
Binding residue
(residue number reindexed from 1)		K7 Q12 E15 K19 P34 A35 H36 M37 K38 K58
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1ekz, PDBe:1ekz, PDBj:1ekz
PDBsum1ekz
PubMed10698941
UniProtP25159|STAU_DROME Maternal effect protein staufen (Gene Name=stau)

[Back to BioLiP]