Structure of PDB 1egp Chain A Binding Site BS01

Receptor Information
>1egp Chain A (length=39) Species: 6421 (Hirudo medicinalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTL
Ligand information
>1egp Chain B (length=22) Species: 6421 (Hirudo medicinalis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YNRVRVFYNPGTNVVNHVPHVG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1egp Structure of the proteinase inhibitor eglin c with hydrolysed reactive centre at 2.0 A resolution.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K8 S9 F10 V13 V14 G15 K16 T17 V18 Y32 N33 V34 Y35 F36 L37 P38 E39 G40
Binding residue
(residue number reindexed from 1)		K2 S3 F4 V7 V8 G9 K10 T11 V12 Y26 N27 V28 Y29 F30 L31 P32 E33 G34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0009611 response to wounding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1egp, PDBe:1egp, PDBj:1egp
PDBsum1egp
PubMed8425603
UniProtP01051|ICIC_HIRME Eglin C

[Back to BioLiP]