Structure of PDB 1ecr Chain A Binding Site BS01

Receptor Information
>1ecr Chain A (length=305) Species: 37762 (Escherichia coli B) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLN
RIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDN
LSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLN
AYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWT
REEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHA
CPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLH
LYVAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ecr Structure of a replication-terminator protein complexed with DNA.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S88 K89 T129 F140 L153 Y156 A173 N174 K175 H176 I177 I178 K179 N180 K229 R241 Q250 H287 R288 Y289 K290 P291
Binding residue
(residue number reindexed from 1)		S84 K85 T125 F136 L149 Y152 A169 N170 K171 H172 I173 I174 K175 N176 K225 R237 Q246 H283 R284 Y285 K286 P287
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006274 DNA replication termination
GO:0071807 replication fork arrest involved in DNA replication termination
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ecr, PDBe:1ecr, PDBj:1ecr
PDBsum1ecr
PubMed8857533
UniProtP16525|TUS_ECOLI DNA replication terminus site-binding protein (Gene Name=tus)

[Back to BioLiP]