Structure of PDB 1ec6 Chain A Binding Site BS01

Receptor Information
>1ec6 Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKELVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRN
RRVTITGSPAATQAAQYLISQRVTYEQGVRASNPQKV
Ligand information
>1ec6 Chain D (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaggaccuagaucaccccuc
<<<<............>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ec6 Sequence-specific RNA binding by a Nova KH domain: implications for paraneoplastic disease and the fragile X syndrome.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		E14 N15 V17 G18 A19 L21 G22 K23 G24 Q40 I41 K43 K44 R54 R83 Q88
Binding residue
(residue number reindexed from 1)		E11 N12 V14 G15 A16 L18 G19 K20 G21 Q37 I38 K40 K41 R51 R80 Q85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1ec6, PDBe:1ec6, PDBj:1ec6
PDBsum1ec6
PubMed10676814
UniProtQ9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 (Gene Name=NOVA2)

[Back to BioLiP]