Structure of PDB 1e8o Chain A Binding Site BS01

Receptor Information
>1e8o Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVY
KTDQAQDVKKIEKFHSQLMRLMVA
Ligand information
>1e8o Chain E (length=50) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggccgggcgcgguggcgcgcgccuguagucccagcuacucgggaggcuc
<<<<<<<<<<<<..(((.>>>>>>>....<<<<.)))....>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1e8o Structure and Assembly of the Alu Domain of the Mammalian Signal Recognition Particle
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K60 K64 S67 R71
Binding residue
(residue number reindexed from 1)		K59 K63 S66 R70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005047 signal recognition particle binding
GO:0005515 protein binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0045900 negative regulation of translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005785 signal recognition particle receptor complex
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1e8o, PDBe:1e8o, PDBj:1e8o
PDBsum1e8o
PubMed11089964
UniProtP49458|SRP09_HUMAN Signal recognition particle 9 kDa protein (Gene Name=SRP9)

[Back to BioLiP]