Structure of PDB 1dy9 Chain A Binding Site BS01

Receptor Information

>1dy9 Chain A (length=175) Species: 31645 (Hepatitis C virus (isolate Taiwan))

APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNG
VCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHV
VGIFRAAVCTRGVAKAVDFIPVESM

Ligand information

>1dy9 Chain C (length=12) Species: 31645 (Hepatitis C virus (isolate Taiwan))

GSVVIVGRIILS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1dy9 Inhibition of the Hepatitis C Virus Ns3/4A Protease the Crystal Structures of Two Protease-Inhibitor Complexes
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): T4 A5 Y6 S7 Q8 T10 R11 C16 S20 Q28 D30 E32 V33 Q34 V35 L36 S37 K62 T63 L64
• Binding residue (residue number reindexed from 1): T4 A5 Y6 S7 Q8 T10 R11 C16 S20 Q28 D30 E32 V33 Q34 V35 L36 S37 K62 T63 L64

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H57 D81 G137 S139
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:1dy9, PDBe:1dy9, PDBj:1dy9
• PDBsum: 1dy9
• PubMed: 10702283
• UniProt: P26662|POLG_HCVJA Genome polyprotein