Structure of PDB 1du0 Chain A Binding Site BS01

Receptor Information
>1du0 Chain A (length=53) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFANKRAKI
KKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1du0 Exploring the role of glutamine 50 in the homeodomain-DNA interface: crystal structure of engrailed (Gln50 --> ala) complex at 2.0 A.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		F8 Q44 I47 N51
Binding residue
(residue number reindexed from 1)		F2 Q38 I41 N45
Binding affinityPDBbind-CN: Kd=79pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1du0, PDBe:1du0, PDBj:1du0
PDBsum1du0
PubMed10889025
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]