Structure of PDB 1ds6 Chain A Binding Site BS01

Receptor Information
>1ds6 Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKP
VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPE
VRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEID
SVKYLECSALTQRGLKTVFDEAIRAVLCPQP
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain1ds6 Chain A Residue 193 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ds6 The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		T17 T35
Binding residue
(residue number reindexed from 1)		T17 T35
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019887 protein kinase regulator activity
Biological Process
GO:0006935 chemotaxis
GO:0007015 actin filament organization
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007264 small GTPase-mediated signal transduction
GO:0008283 cell population proliferation
GO:0010310 regulation of hydrogen peroxide metabolic process
GO:0010592 positive regulation of lamellipodium assembly
GO:0010810 regulation of cell-substrate adhesion
GO:0030031 cell projection assembly
GO:0030036 actin cytoskeleton organization
GO:0042129 regulation of T cell proliferation
GO:0043131 erythrocyte enucleation
GO:0043304 regulation of mast cell degranulation
GO:0045453 bone resorption
GO:0045730 respiratory burst
GO:0060263 regulation of respiratory burst
GO:0060753 regulation of mast cell chemotaxis
GO:0070662 mast cell proliferation
GO:0070668 positive regulation of mast cell proliferation
GO:0071593 lymphocyte aggregation
GO:0090023 positive regulation of neutrophil chemotaxis
GO:1902622 regulation of neutrophil migration
GO:1903955 positive regulation of protein targeting to mitochondrion
Cellular Component
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005741 mitochondrial outer membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005884 actin filament
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0030027 lamellipodium
GO:0030670 phagocytic vesicle membrane
GO:0043020 NADPH oxidase complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ds6, PDBe:1ds6, PDBj:1ds6
PDBsum1ds6
PubMed10655614
UniProtP15153|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 (Gene Name=RAC2)

[Back to BioLiP]