Structure of PDB 1dpu Chain A Binding Site BS01

Receptor Information
>1dpu Chain A (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSN
EGHIYSTVDDDHFKSTDAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dpu Structural basis for the recognition of DNA repair proteins UNG2, XPA, and RAD52 by replication factor RPA.
ResolutionN/A
Binding residue
(original residue number in PDB)		S250 N251 E252 G253 Y256 S257 T258 V259 D261 T267
Binding residue
(residue number reindexed from 1)		S49 N50 E51 G52 Y55 S56 T57 V58 D60 T66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1dpu, PDBe:1dpu, PDBj:1dpu
PDBsum1dpu
PubMed11081631
UniProtP15927|RFA2_HUMAN Replication protein A 32 kDa subunit (Gene Name=RPA2)

[Back to BioLiP]