Structure of PDB 1doj Chain A Binding Site BS01

Receptor Information
>1doj Chain A (length=293) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFGSGEADCGLRPLFEKKSLEDKTERELLESYIDIVEGSDAEIGMSPWQV
MLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKH
SRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIH
PVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLP
IVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFN
NRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1doj Structure of human alpha-thrombin complexed with RWJ-51438 at 1.7 A: unusual perturbation of the 60A-60I insertion loop.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		F34 Q38 L65 R67 R73 T74 R75 Y76 K81 I82 M84
Binding residue
(residue number reindexed from 1)		F53 Q58 L94 R96 R102 T103 R104 Y105 K111 I112 M114
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 E192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H77 D133 E236 G237 D238 S239 G240
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1doj, PDBe:1doj, PDBj:1doj
PDBsum1doj
PubMed11053836
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]