Structure of PDB 1dnk Chain A Binding Site BS01

Receptor Information

>1dnk Chain A (length=250) Species: 9913 (Bos taurus)

LKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGK
LLDYLNQDDPNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYSFS
REPAVVKFSSHSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHL
NDVMLMGDFNADCSYVTSSQWSSIRLRTSSTFQWLIPDSADTTATSTNCA
YDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHYPVEVTLT

Ligand information

>1dnk Chain B (length=7)

ggtatac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1dnk X-ray structure of the DNase I-d(GGTATACC)2 complex at 2.3 A resolution.
• Resolution: 2.3 Å
• Binding residue (original residue number in PDB): T14 R41 D42 S43
• Binding residue (residue number reindexed from 1): T14 R41 D42 S43

Enzymatic activity

• Catalytic site (original residue number in PDB): E39 Y76 E78 H134 D168 D212 H252
• Catalytic site (residue number reindexed from 1): E39 Y76 E78 H124 D158 D202 H242
• Enzyme Commision number: 3.1.21.1: deoxyribonuclease I.

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003779 actin binding
• GO:0003824 catalytic activity
• GO:0004519 endonuclease activity
• GO:0004530 deoxyribonuclease I activity
• GO:0004536 DNA nuclease activity
• GO:0005515 protein binding

Biological Process

• GO:0002283 neutrophil activation involved in immune response
• GO:0002673 regulation of acute inflammatory response
• GO:0006308 DNA catabolic process
• GO:0006915 apoptotic process
• GO:0070948 regulation of neutrophil mediated cytotoxicity

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005635 nuclear envelope
• GO:0031410 cytoplasmic vesicle
• GO:0042588 zymogen granule

External links

• PDB: RCSB:1dnk, PDBe:1dnk, PDBj:1dnk
• PDBsum: 1dnk
• PubMed: 1518054
• UniProt: P00639|DNAS1_BOVIN Deoxyribonuclease-1 (Gene Name=DNASE1)