Structure of PDB 1dmu Chain A Binding Site BS01

Receptor Information
>1dmu Chain A (length=299) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYNLHREKIFMSYNQNKQYLEDNPEIQEKIELYGLNLLNEVISDNEEEIR
ADYNEANFLHPFWMNYPPLDRGKMPKGDQIPWIEVGEKAVGSKLTRLVSQ
REDITVREIGLPTGPDERYLLTSPTIYSLTNGFTDSIMMFVDIKSVGPRD
SDYDLVLSPNQVSGNGDWAQLEGGIQNNQQTIQGPRSSQIFLPTIPPLYI
LSDGTIAPVVHLFIKPIYAMRSLTKGDTGQSLYKIKLASVPNGLGLFCNP
GYAFDSAYKFLFRPGKDDRTKSLLQKRVRVDLRVLDKIGPRVMTIDMDK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dmu Crystal structure of restriction endonuclease BglI bound to its interrupted DNA recognition sequence.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K73 M74 K76 Q79 I83 D116 S145 V146 G147 R149 D150 N160 Y218 K266 R277
Binding residue
(residue number reindexed from 1)		K73 M74 K76 Q79 I83 D116 S145 V146 G147 R149 D150 N160 Y218 K266 R277
Enzymatic activity
Catalytic site (original residue number in PDB) D116 D142 I143 K144
Catalytic site (residue number reindexed from 1) D116 D142 I143 K144
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dmu, PDBe:1dmu, PDBj:1dmu
PDBsum1dmu
PubMed9736624
UniProtO68557|T2B1_BACIU Type II restriction enzyme BglI (Gene Name=bglIR)

[Back to BioLiP]