Structure of PDB 1dkd Chain A Binding Site BS01

Receptor Information
>1dkd Chain A (length=146) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAV
AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQ
DIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dkd The crystal structure of a GroEL/peptide complex: plasticity as a basis for substrate diversity.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R231 L237 E238 T261 N265 I270
Binding residue
(residue number reindexed from 1)		R41 L47 E48 T71 N75 I80
Enzymatic activity
Enzyme Commision number 5.6.1.7: chaperonin ATPase.
Gene Ontology
Molecular Function
GO:0140662 ATP-dependent protein folding chaperone
Biological Process
GO:0042026 protein refolding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dkd, PDBe:1dkd, PDBj:1dkd
PDBsum1dkd
PubMed10619429
UniProtP0A6F5|CH60_ECOLI Chaperonin GroEL (Gene Name=groEL)

[Back to BioLiP]