Structure of PDB 1dk1 Chain A Binding Site BS01

Receptor Information
>1dk1 Chain A (length=86) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI
Ligand information
>1dk1 Chain B (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcggccuucgggcuagacggugggagaggcuucggcugguccacccgu
gacgcuc
<<<<.<<<....>>>...<<<<<<<<...<<<....>>>..>>>>>.>>>
...>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dk1 Crystal structure of the S15-rRNA complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		P101 K107 M111 T121 G122 S123 Q127 L130 R134 L138 H141 H145 K147 D148 H150 S151 M158 R164 Y168
Binding residue
(residue number reindexed from 1)		P1 K7 M11 T21 G22 S23 Q27 L30 R34 L38 H41 H45 K47 D48 H50 S51 M58 R64 Y68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1dk1, PDBe:1dk1, PDBj:1dk1
PDBsum1dk1
PubMed10742169
UniProtP80378|RS15_THETH Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]