Structure of PDB 1dgc Chain A Binding Site BS01

Receptor Information
>1dgc Chain A (length=55) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKK
LVGER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dgc The X-ray structure of the GCN4-bZIP bound to ATF/CREB site DNA shows the complex depends on DNA flexibility.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R232 N235 T236 R240 R243
Binding residue
(residue number reindexed from 1)		R6 N9 T10 R14 R17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dgc, PDBe:1dgc, PDBj:1dgc
PDBsum1dgc
PubMed8377181
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4)

[Back to BioLiP]