Structure of PDB 1ddv Chain A Binding Site BS01

Receptor Information
>1ddv Chain A (length=104) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKA
IINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQE
FKEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ddv Structure of the Homer EVH1 domain-peptide complex reveals a new twist in polyproline recognition.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		F14 W24 S71 K73 F74 G89 F90
Binding residue
(residue number reindexed from 1)		F9 W19 S66 K68 F69 G84 F85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035256 G protein-coupled glutamate receptor binding
Biological Process
GO:0007216 G protein-coupled glutamate receptor signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ddv, PDBe:1ddv, PDBj:1ddv
PDBsum1ddv
PubMed10798399
UniProtQ9Z214|HOME1_RAT Homer protein homolog 1 (Gene Name=Homer1)

[Back to BioLiP]