Structure of PDB 1ddn Chain A Binding Site BS01

Receptor Information
>1ddn Chain A (length=118) Species: 1717 (Corynebacterium diphtheriae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDG
LVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEAD
RWEHVMSDEVERRLVKVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ddn Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R27 A28 R29 S42 R60
Binding residue
(residue number reindexed from 1)		R25 A26 R27 S40 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0017124 SH3 domain binding
GO:0042802 identical protein binding
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ddn, PDBe:1ddn, PDBj:1ddn
PDBsum1ddn
PubMed9697776
UniProtP0DJL7|DTXR_CORDI Diphtheria toxin repressor (Gene Name=dtxR)

[Back to BioLiP]