Structure of PDB 1ddm Chain A Binding Site BS01

Receptor Information
>1ddm Chain A (length=135) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRP
VRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRD
GTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLER
Ligand information
>1ddm Chain B (length=11) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GFSNMSFEDFP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ddm Multiple modes of peptide recognition by the PTB domain of the cell fate determinant Numb.
ResolutionN/A
Binding residue
(original residue number in PDB)		I144 E145 K146 S148 F149 C150 P152 S188 F195 C198 L199
Binding residue
(residue number reindexed from 1)		I78 E79 K80 S82 F83 C84 P86 S122 F129 C132 L133
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1ddm, PDBe:1ddm, PDBj:1ddm
PDBsum1ddm
PubMed10747019
UniProtP16554|NUMB_DROME Protein numb (Gene Name=numb)

[Back to BioLiP]