Structure of PDB 1d9k Chain A Binding Site BS01

Receptor Information

>1d9k Chain A (length=110) Species: 10090 (Mus musculus)

QVRQSPQSLTVWEGETTILNCSYEDSTFDYFPWYRQFPGKSPALLIAISL
VSNKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAATGSFNKLTFG
AGTRLAVSPY

Ligand information

>1d9k Chain P (length=16) Species: 10090 (Mus musculus)

GNSHRGAIEWEGIESG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1d9k The crystal structure of a T cell receptor in complex with peptide and MHC class II.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): T28 G99 S100 F101
• Binding residue (residue number reindexed from 1): T27 G92 S93 F94

External links

• PDB: RCSB:1d9k, PDBe:1d9k, PDBj:1d9k
• PDBsum: 1d9k
• PubMed: 10583947
• UniProt: P01739|TVA2_MOUSE T-cell receptor alpha chain V region 2B4