Structure of PDB 1d6g Chain A Binding Site BS01

Receptor Information
>1d6g Chain A (length=47) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAQVILL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d6g Molecular complex of cholecystokinin-8 and N-terminus of the cholecystokinin A receptor by NMR spectroscopy.
ResolutionN/A
Binding residue
(original residue number in PDB)
R34 P35 W39 Q43 L46
Binding residue
(residue number reindexed from 1)
R34 P35 W39 Q43 L46
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1d6g, PDBe:1d6g, PDBj:1d6g
PDBsum1d6g
PubMed10555959
UniProtP32238|CCKAR_HUMAN Cholecystokinin receptor type A (Gene Name=CCKAR)

[Back to BioLiP]