Structure of PDB 1d5m Chain A Binding Site BS01

Receptor Information
>1d5m Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFAS
FEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPN
VLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPF
LPSTEDVYDCRVEHWGLDEPLLKHWEFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d5m Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
Q9 E11 S53 F54 N62 V65
Binding residue
(residue number reindexed from 1)
Q6 E8 S50 F51 N59 V62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1d5m, PDBe:1d5m, PDBj:1d5m
PDBsum1d5m
PubMed10841792
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]