Structure of PDB 1d5g Chain A Binding Site BS01

Receptor Information
>1d5g Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDG
RIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d5g Solution Structure of the PDZ2 Domain from Cytosolic Human Phosphatase hPTP1E Complexed with a Peptide Reveals Contribution of the beta2-beta3 Loop to PDZ Domain-Ligand Interactions
ResolutionN/A
Binding residue
(original residue number in PDB)
L18 G19 I20 S21 V22 V26 H71 V75 R79
Binding residue
(residue number reindexed from 1)
L18 G19 I20 S21 V22 V26 H71 V75 R79
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:1d5g, PDBe:1d5g, PDBj:1d5g
PDBsum1d5g
PubMed12095257
UniProtQ12923|PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 (Gene Name=PTPN13)

[Back to BioLiP]