Structure of PDB 1d02 Chain A Binding Site BS01

Receptor Information
>1d02 Chain A (length=197) Species: 2093 (Mycoplasma) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSGRLNWQALAGLKASGAEQNLYNVFNAVFEGTKYVLYEKPKHLKNLYAQ
VVLPDDVIKEIFNPLIDLSTTQWGVSPAFAIENTETHKILFGEIKRQDGW
VEGKDPSAGRGNAHERSCKLFTPGLLKAYRTIGGINDEEILPFWVVFEGD
ITRDPKRVREITFWYDHYQDNYFMWRPNESGEKLVQHFNEKLKKYLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d02 Crystal structure of MunI restriction endonuclease in complex with cognate DNA at 1.7 A resolution.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R115 N117 K161
Binding residue
(residue number reindexed from 1)		R110 N112 K156
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1d02, PDBe:1d02, PDBj:1d02
PDBsum1d02
PubMed10545092
UniProtP43642|T2MU_MYCSP Type II restriction enzyme MunI (Gene Name=munIR)

[Back to BioLiP]