Structure of PDB 1cw0 Chain A Binding Site BS01

Receptor Information
>1cw0 Chain A (length=155) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADVHDKATRSKNMRAIATRDTAIEKRLASLLTGQGLAFRVQDASLPGRPD
FVVDEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDI
SRLQELGWRVLIVWECALRGREKLTDEALTERLEEWICGEGASAQIDTQG
IHLLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cw0 Recognition of a TG mismatch: the crystal structure of very short patch repair endonuclease in complex with a DNA duplex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		A2 D3 V4 R10 S11 M14 R15 F67 W68 P79 A80 T81 R82 W86 K89 G121 R122
Binding residue
(residue number reindexed from 1)		A1 D2 V3 R9 S10 M13 R14 F66 W67 P78 A79 T80 R81 W85 K88 G120 R121
Enzymatic activity
Catalytic site (original residue number in PDB) D51 T63 H69 D97
Catalytic site (residue number reindexed from 1) D50 T62 H68 D96
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
GO:0043765 T/G mismatch-specific endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006298 mismatch repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cw0, PDBe:1cw0, PDBj:1cw0
PDBsum1cw0
PubMed10612397
UniProtP09184|VSR_ECOLI DNA mismatch endonuclease Vsr (Gene Name=vsr)

[Back to BioLiP]