Structure of PDB 1cvj Chain A Binding Site BS01

Receptor Information
>1cvj Chain A (length=169) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSI
DNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNG
MLLNDRKVFVGRFKSRKER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cvj Recognition of polyadenylate RNA by the poly(A)-binding protein.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y14 E24 R41 V42 R44 D45 M46 R49 Y54 Y56 N58 R83 M85 S87 Q88 R89 R94 N100 F102 K104 N105 S127 G139 Y140 F142 H144 F169 F173 K174 S175 R176 R179
Binding residue
(residue number reindexed from 1)		Y4 E14 R31 V32 R34 D35 M36 R39 Y44 Y46 N48 R73 M75 S77 Q78 R79 R84 N90 F92 K94 N95 S117 G129 Y130 F132 H134 F159 F163 K164 S165 R166 R169
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1cvj, PDBe:1cvj, PDBj:1cvj
PDBsum1cvj
PubMed10499800
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]