Structure of PDB 1cqt Chain A Binding Site BS01

Receptor Information
>1cqt Chain A (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFE
ALNLSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPT
SEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cqt Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		T26 Q27 Q44 T45 S48 R102 K103 R105 T106 I108 N151
Binding residue
(residue number reindexed from 1)		T25 Q26 Q43 T44 S47 R75 K76 R78 T79 I81 N124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cqt, PDBe:1cqt, PDBj:1cqt
PDBsum1cqt
PubMed10541551
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]