Structure of PDB 1cqh Chain A Binding Site BS01

Receptor Information
>1cqh Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYS
NVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEAT
INELV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cqh The solution structure of human thioredoxin complexed with its target from Ref-1 reveals peptide chain reversal.
ResolutionN/A
Binding residue
(original residue number in PDB)		W31 C32 V59 V71 K72 A73 T74 G91
Binding residue
(residue number reindexed from 1)		W31 C32 V59 V71 K72 A73 T74 G91
Enzymatic activity
Catalytic site (original residue number in PDB) C32 G33 P34 A35
Catalytic site (residue number reindexed from 1) C32 G33 P34 A35
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
GO:0005515 protein binding
GO:0015035 protein-disulfide reductase activity
GO:0042803 protein homodimerization activity
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0009314 response to radiation
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0043388 positive regulation of DNA binding
GO:0045454 cell redox homeostasis
GO:0046826 negative regulation of protein export from nucleus
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0061692 cellular detoxification of hydrogen peroxide
GO:0071731 response to nitric oxide
GO:2000170 positive regulation of peptidyl-cysteine S-nitrosylation
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cqh, PDBe:1cqh, PDBj:1cqh
PDBsum1cqh
PubMed8736558
UniProtP10599|THIO_HUMAN Thioredoxin (Gene Name=TXN)

[Back to BioLiP]