Structure of PDB 1ckt Chain A Binding Site BS01

Receptor Information
>1ckt Chain A (length=71) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEK
GKFEDMAKADKARYEREMKTY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ckt Basis for recognition of cisplatin-modified DNA by high-mobility-group proteins.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K11 Y15 F37 S41 K42 S45
Binding residue
(residue number reindexed from 1)		K5 Y9 F31 S35 K36 S39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ckt, PDBe:1ckt, PDBj:1ckt
PDBsum1ckt
PubMed10385126
UniProtP63159|HMGB1_RAT High mobility group protein B1 (Gene Name=Hmgb1)

[Back to BioLiP]